SCOPe 2.05: Domain d2xxtb_: 2xxt B:

Lineage for d2xxtb_ (2xxt B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (78 PDB entries)

8. Domain d2xxtb_: 2xxt B: [207419]
   automated match to d2znta_
   complexed with cl, kai, na

Details for d2xxtb_

PDB Entry: 2xxt, 1.9 Å

PDB Description: crystal structure of the gluk2 (glur6) wild-type lbd dimer in complex with kainate

PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d2xxtb_:

Sequence; same for both SEQRES and ATOM records:

>d2xxtb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeegkl
hmmkekww

Timeline for d2xxtb_:

• d2xxtb_ first appeared in SCOPe 2.03
  
• d2xxtb_ appears in SCOPe 2.04
  
• d2xxtb_ appears in SCOPe 2.06
  
• d2xxtb_ appears in the current release, SCOPe 2.08