SCOPe 2.08: Domain d2xxjd2: 2xxj D:142-310

Lineage for d2xxjd2 (2xxj D:142-310)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)

8. Domain d2xxjd2: 2xxj D:142-310 [207415]
   Other proteins in same PDB: d2xxja1, d2xxjb1, d2xxjc1, d2xxjd1
   automated match to d1llda2
   complexed with nad, oxm, so4; mutant

Details for d2xxjd2

PDB Entry: 2xxj, 1.96 Å

PDB Description: penta mutant of lactate dehydrogenase from thermus thermophilus, ternary complex

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxjd2:

Sequence; same for both SEQRES and ATOM records:

>d2xxjd2 d.162.1.0 (D:142-310) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpevag
vlevslslprilgaggvagtvypslspeeraalrrsaeilkeaafalgf

Timeline for d2xxjd2:

• d2xxjd2 first appeared in SCOPe 2.03
  
• d2xxjd2 appears in SCOPe 2.07