Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein automated matches [226877] (4 species) not a true protein |
Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries) |
Domain d2xxgc1: 2xxg C:2-159 [207406] automated match to d1gs7a1 complexed with cu, mes, peg, pg4, zn; mutant |
PDB Entry: 2xxg (more details), 1.6 Å
SCOPe Domain Sequences for d2xxgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xxgc1 b.6.1.3 (C:2-159) automated matches {Achromobacter xylosoxidans [TaxId: 85698]} dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs mpgptlvvhegdyvqltlvnpatnamphsvdfhgatgalggakltnvnpgeqatlrfkad rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
Timeline for d2xxgc1: