| Class b: All beta proteins [48724] (174 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
| Protein automated matches [226877] (2 species) not a true protein |
| Species Achromobacter xylosoxidans [TaxId:85698] [225099] (5 PDB entries) |
| Domain d2xxga2: 2xxg A:160-336 [207405] automated match to d1oe1a2 complexed with cu, mes, peg, pg4, zn; mutant |
PDB Entry: 2xxg (more details), 1.6 Å
SCOPe Domain Sequences for d2xxga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xxga2 b.6.1.3 (A:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
Timeline for d2xxga2: