SCOPe 2.03: Domain d2xx7a_: 2xx7 A:

Lineage for d2xx7a_ (2xx7 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (13 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (25 PDB entries)

8. Domain d2xx7a_: 2xx7 A: [207393]
   automated match to d3tkda_
   complexed with 1nd, glu, so4, zn

Details for d2xx7a_

PDB Entry: 2xx7, 2.2 Å

PDB Description: crystal structure of 1-(4-(1-pyrrolidinylcarbonyl)phenyl)-3-(trifluoromethyl)-4,5,6,7-tetrahydro-1h-indazole in complex with the ligand binding domain of the rat glua2 receptor and glutamate at 2.2a resolution.

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2xx7a_:

Sequence; same for both SEQRES and ATOM records:

>d2xx7a_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
lseqglldklknkwwydkgecg

Timeline for d2xx7a_:

• d2xx7a_ is new in SCOPe 2.03-stable
  
• d2xx7a_ appears in SCOPe 2.04
  
• d2xx7a_ appears in the current release, SCOPe 2.08, called d2xx7a1