SCOPe 2.08: Domain d2xx7a1: 2xx7 A:3-262

Lineage for d2xx7a1 (2xx7 A:3-262)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)

8. Domain d2xx7a1: 2xx7 A:3-262 [207393]
   Other proteins in same PDB: d2xx7a2, d2xx7b2
   automated match to d3tkda_
   complexed with 1nd, glu, so4, zn

Details for d2xx7a1

PDB Entry: 2xx7, 2.2 Å

PDB Description: crystal structure of 1-(4-(1-pyrrolidinylcarbonyl)phenyl)-3-(trifluoromethyl)-4,5,6,7-tetrahydro-1h-indazole in complex with the ligand binding domain of the rat glua2 receptor and glutamate at 2.2a resolution.

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2xx7a1:

Sequence; same for both SEQRES and ATOM records:

>d2xx7a1 c.94.1.1 (A:3-262) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecg

Timeline for d2xx7a1:

• d2xx7a1 first appeared in SCOPe 2.03, called d2xx7a_
  
• d2xx7a1 appears in SCOPe 2.07