SCOPe 2.08: Domain d2xx6b_: 2xx6 B:

Lineage for d2xx6b_ (2xx6 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (20 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)

8. Domain d2xx6b_: 2xx6 B: [207390]
   automated match to d2bazc_

Details for d2xx6b_

PDB Entry: 2xx6, 1.74 Å

PDB Description: structure of the bacillus subtilis prophage dutpase, yoss

PDB Compounds: (B:) spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss

SCOPe Domain Sequences for d2xx6b_:

Sequence, based on SEQRES records:

>d2xx6b_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
dlievdrl

Sequence, based on observed residues (ATOM records):

>d2xx6b_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtringdwidlraaedvaikkdefklvplgvamelpegyeahvvprsst
yknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavdlie
vdrl

Timeline for d2xx6b_:

• d2xx6b_ first appeared in SCOPe 2.03
  
• d2xx6b_ appears in SCOPe 2.07