Lineage for d2xx3a_ (2xx3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866286Species Human (Homo sapiens) [TaxId:9606] [187523] (8 PDB entries)
  8. 2866291Domain d2xx3a_: 2xx3 A: [207388]
    automated match to d1e2fa_
    complexed with adp, mg, no3, tae

Details for d2xx3a_

PDB Entry: 2xx3 (more details), 2 Å

PDB Description: human thymidylate kinase complexed with thymidine butenyl phosphonate monophosphate and adp
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2xx3a_:

Sequence, based on SEQRES records: (download)

>d2xx3a_ c.37.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdv
glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
sieavhedirvlsedairtatekplgelwk

Sequence, based on observed residues (ATOM records): (download)

>d2xx3a_ c.37.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arrgalivlegvdragkstqsrklvealcahraellrfpersteigkllsvedhsvhllf
sanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvglpkpdlvlf
lqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasksieavhedir
vlsedairtatekplgelwk

SCOPe Domain Coordinates for d2xx3a_:

Click to download the PDB-style file with coordinates for d2xx3a_.
(The format of our PDB-style files is described here.)

Timeline for d2xx3a_: