SCOPe 2.03: Domain d2xwze2: 2xwz E:160-336

Lineage for d2xwze2 (2xwz E:160-336)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (25 PDB entries)
   Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601

8. Domain d2xwze2: 2xwz E:160-336 [207381]
   automated match to d1oe1a2
   complexed with act, cu, no, no2, so4

Details for d2xwze2

PDB Entry: 2xwz, 2.34 Å

PDB Description: structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite

PDB Compounds: (E:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2xwze2:

Sequence; same for both SEQRES and ATOM records:

>d2xwze2 b.6.1.3 (E:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

Timeline for d2xwze2:

• d2xwze2 is new in SCOPe 2.03-stable
  
• d2xwze2 appears in SCOPe 2.04
  
• d2xwze2 appears in the current release, SCOPe 2.08