Lineage for d2xwze1 (2xwz E:2-159)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381575Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 2381632Domain d2xwze1: 2xwz E:2-159 [207380]
    automated match to d1oe1a1
    complexed with act, cu, no, no2, so4

Details for d2xwze1

PDB Entry: 2xwz (more details), 2.34 Å

PDB Description: structure of the recombinant native nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
PDB Compounds: (E:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2xwze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xwze1 b.6.1.3 (E:2-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d2xwze1:

Click to download the PDB-style file with coordinates for d2xwze1.
(The format of our PDB-style files is described here.)

Timeline for d2xwze1: