Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries) Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601 |
Domain d2xwze1: 2xwz E:2-159 [207380] automated match to d1oe1a1 complexed with act, cu, no, no2, so4 |
PDB Entry: 2xwz (more details), 2.34 Å
SCOPe Domain Sequences for d2xwze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xwze1 b.6.1.3 (E:2-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
Timeline for d2xwze1: