SCOPe 2.03: Domain d2xwmb_: 2xwm B:

Lineage for d2xwmb_ (2xwm B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (20 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226121] (1 PDB entry)

8. Domain d2xwmb_: 2xwm B: [207370]
   automated match to d1vgta_
   complexed with c5p

Details for d2xwmb_

PDB Entry: 2xwm, 1.8 Å

PDB Description: crystal structure of ispd from mycobacterium smegmatis in complex with cmp

PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2xwmb_:

Sequence; same for both SEQRES and ATOM records:

>d2xwmb_ c.68.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
atvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltdes
klvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalkeg
hsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvtd
daslveqlgtpvqivdgdplafkittpldlvlaeavlahhhh

Timeline for d2xwmb_:

• d2xwmb_ is new in SCOPe 2.03-stable
  
• d2xwmb_ appears in SCOPe 2.04
  
• d2xwmb_ appears in the current release, SCOPe 2.08, called d2xwmb1