![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [226121] (1 PDB entry) |
![]() | Domain d2xwmb1: 2xwm B:2-219 [207370] Other proteins in same PDB: d2xwma2, d2xwmb2 automated match to d1vgta_ complexed with c5p |
PDB Entry: 2xwm (more details), 1.8 Å
SCOPe Domain Sequences for d2xwmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xwmb1 c.68.1.0 (B:2-219) automated matches {Mycobacterium smegmatis [TaxId: 246196]} atvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltdes klvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalkeg hsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvtd daslveqlgtpvqivdgdplafkittpldlvlaeavla
Timeline for d2xwmb1: