Lineage for d2xwmb1 (2xwm B:2-219)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899368Species Mycobacterium smegmatis [TaxId:246196] [226121] (1 PDB entry)
  8. 2899370Domain d2xwmb1: 2xwm B:2-219 [207370]
    Other proteins in same PDB: d2xwma2, d2xwmb2
    automated match to d1vgta_
    complexed with c5p

Details for d2xwmb1

PDB Entry: 2xwm (more details), 1.8 Å

PDB Description: crystal structure of ispd from mycobacterium smegmatis in complex with cmp
PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2xwmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xwmb1 c.68.1.0 (B:2-219) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
atvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltdes
klvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalkeg
hsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvtd
daslveqlgtpvqivdgdplafkittpldlvlaeavla

SCOPe Domain Coordinates for d2xwmb1:

Click to download the PDB-style file with coordinates for d2xwmb1.
(The format of our PDB-style files is described here.)

Timeline for d2xwmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xwmb2