Lineage for d2xw0a2 (2xw0 A:197-388)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013468Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2013469Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2013470Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
    Uniprot P02768 29-596
  8. 2013550Domain d2xw0a2: 2xw0 A:197-388 [207356]
    automated match to d1n5ua2
    complexed with 9nf

Details for d2xw0a2

PDB Entry: 2xw0 (more details), 2.4 Å

PDB Description: human serum albumin complexed with dansyl-l-phenylalanine
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2xw0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xw0a2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d2xw0a2:

Click to download the PDB-style file with coordinates for d2xw0a2.
(The format of our PDB-style files is described here.)

Timeline for d2xw0a2: