Lineage for d2xvqb3 (2xvq B:389-582)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281391Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1281392Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1281393Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1281394Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1281395Species Human (Homo sapiens) [TaxId:9606] [48555] (74 PDB entries)
    Uniprot P02768 29-596
  8. 1281654Domain d2xvqb3: 2xvq B:389-582 [207348]
    automated match to d1n5ua3
    complexed with 9ds

Details for d2xvqb3

PDB Entry: 2xvq (more details), 2.9 Å

PDB Description: human serum albumin complexed with dansyl-l-sarcosine
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2xvqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvqb3 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

SCOPe Domain Coordinates for d2xvqb3:

Click to download the PDB-style file with coordinates for d2xvqb3.
(The format of our PDB-style files is described here.)

Timeline for d2xvqb3: