SCOPe 2.03: Domain d2xuua_: 2xuu A:

Lineage for d2xuua_ (2xuu A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (418 PDB entries)

8. Domain d2xuua_: 2xuu A: [207341]
   automated match to d2xzsa_
   complexed with adp, mg, so4; mutant

Details for d2xuua_

PDB Entry: 2xuu, 1.8 Å

PDB Description: Crystal structure of a DAP-kinase 1 mutant

PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d2xuua_:

Sequence; same for both SEQRES and ATOM records:

>d2xuua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
afvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfaa
r

Timeline for d2xuua_:

• d2xuua_ is new in SCOPe 2.03-stable
  
• d2xuua_ appears in SCOPe 2.04
  
• d2xuua_ appears in the current release, SCOPe 2.08