Lineage for d2xu5a_ (2xu5 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155438Species Human (Homo sapiens) [TaxId:9606] [187072] (42 PDB entries)
  8. 2155448Domain d2xu5a_: 2xu5 A: [207340]
    automated match to d3hd3b_
    complexed with flc, gol, xu5

Details for d2xu5a_

PDB Entry: 2xu5 (more details), 1.6 Å

PDB Description: cathepsin l with a nitrile inhibitor
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d2xu5a_:

Sequence, based on SEQRES records: (download)

>d2xu5a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Sequence, based on observed residues (ATOM records): (download)

>d2xu5a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfednnkywl
vknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d2xu5a_:

Click to download the PDB-style file with coordinates for d2xu5a_.
(The format of our PDB-style files is described here.)

Timeline for d2xu5a_: