Lineage for d1hsad1 (1hsa D:182-276)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8281Species Human (Homo sapiens), HLA-B2705 [TaxId:9606] [48949] (1 PDB entry)
  8. 8284Domain d1hsad1: 1hsa D:182-276 [20734]
    Other proteins in same PDB: d1hsaa2, d1hsad2

Details for d1hsad1

PDB Entry: 1hsa (more details), 2.1 Å

PDB Description: the three-dimensional structure of hla-b27 at 2.1 angstroms resolution suggests a general mechanism for tight peptide binding to mhc

SCOP Domain Sequences for d1hsad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsad1 b.1.1.2 (D:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B2705}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1hsad1:

Click to download the PDB-style file with coordinates for d1hsad1.
(The format of our PDB-style files is described here.)

Timeline for d1hsad1: