Lineage for d2xtjd_ (2xtj D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356317Domain d2xtjd_: 2xtj D: [207337]
    Other proteins in same PDB: d2xtja_, d2xtjb_
    automated match to d3k80a_
    complexed with ca

Details for d2xtjd_

PDB Entry: 2xtj (more details), 2.7 Å

PDB Description: the crystal structure of pcsk9 in complex with 1d05 fab
PDB Compounds: (D:) fab from a human monoclonal antibody, 1d05

SCOPe Domain Sequences for d2xtjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xtjd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfnshaiswvrqapgqglewmgginpilgiany
aqkfqgrvtitadeststaymelsslrsedtavyycarhyeiqigrygmnvyylmyrfas
wgqgtlvtvss

SCOPe Domain Coordinates for d2xtjd_:

Click to download the PDB-style file with coordinates for d2xtjd_.
(The format of our PDB-style files is described here.)

Timeline for d2xtjd_: