SCOPe 2.04: Domain d2xtjb_: 2xtj B:

Lineage for d2xtjb_ (2xtj B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d2xtjb_: 2xtj B: [207336]
   Other proteins in same PDB: d2xtja_, d2xtjd_
   automated match to d1fvcc_
   complexed with ca

Details for d2xtjb_

PDB Entry: 2xtj, 2.7 Å

PDB Description: the crystal structure of pcsk9 in complex with 1d05 fab

PDB Compounds: (B:) fab from a human monoclonal antibody, 1d05

SCOPe Domain Sequences for d2xtjb_:

Sequence; same for both SEQRES and ATOM records:

>d2xtjb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgirsalnwyqqkpgkapklliyngstlqsgvps
rfsgsgsgtdftltisslqpedfavyycqqfdgdptfgqgtkveikr

Timeline for d2xtjb_:

• d2xtjb_ first appeared in SCOPe 2.03
  
• d2xtjb_ appears in SCOPe 2.05
  
• d2xtjb_ appears in the current release, SCOPe 2.08