Lineage for d2xtba1 (2xtb A:1-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137950Species Trypanosoma brucei [TaxId:31286] [226169] (1 PDB entry)
  8. 2137951Domain d2xtba1: 2xtb A:1-343 [207334]
    Other proteins in same PDB: d2xtba2
    automated match to d2absa1
    complexed with krm

Details for d2xtba1

PDB Entry: 2xtb (more details), 2.8 Å

PDB Description: crystal structure of trypanosoma brucei rhodesiense adenosine kinase complexed with activator
PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d2xtba1:

Sequence, based on SEQRES records: (download)

>d2xtba1 c.72.1.0 (A:1-343) automated matches {Trypanosoma brucei [TaxId: 31286]}
masaplrvyvqcnplldvsahvsdeflvkyglergtaillserqkgifddiekmpnvryv
pggsglnvarvaqwmqqaykgkfvtyvgciaddrygkvlkeaaehegivmavehttkags
gacavcitgkertlvadlgaanhlssehmrspavvramdesrifyfsgftltvdvnhvlq
acrkarevdglfminlsapfimqffsaqlgevlpytdiivanrheakefanmmkwdtdcv
eeiarravsevpytgtkgrvvvftrdiestvlatkdgvetvpvpqldqdkvidmngagda
fmggflsayavgkdlrrccetghytaqeviqrdgcsfpekpsf

Sequence, based on observed residues (ATOM records): (download)

>d2xtba1 c.72.1.0 (A:1-343) automated matches {Trypanosoma brucei [TaxId: 31286]}
masaplrvyvqcnplldvsahvsdeflvkyglergtaillserqkgifddiekmpnvryv
pggsglnvarvaqwmqqaykgkfvtyvgciaddrygkvlkeaaehegivmavehttkags
gacavcitgkertlvadlgaanhlssehmrspavvramdesrifyfsgftltvdvnhvlq
acrkarevdglfminlsapfimqffsaqlgevlpytdiivanrheakefanmmkwdtdcv
eeiarravsevpytgtkgrvvvftrdiestvlatkdgvetvpvpqldqdkvidmngagda
fmggflsayavgkdlrrccetghytaqeviqrkpsf

SCOPe Domain Coordinates for d2xtba1:

Click to download the PDB-style file with coordinates for d2xtba1.
(The format of our PDB-style files is described here.)

Timeline for d2xtba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xtba2