Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225519] (2 PDB entries) |
Domain d2xsxb1: 2xsx B:0-140 [207332] Other proteins in same PDB: d2xsxa2, d2xsxb2 automated match to d1pdza2 complexed with edo, mg, po4 |
PDB Entry: 2xsx (more details), 1.7 Å
SCOPe Domain Sequences for d2xsxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xsxb1 d.54.1.0 (B:0-140) automated matches {Human (Homo sapiens) [TaxId: 9606]} smamqkifareildsrgnptvevdlhtakgrfraavpsgastgiyealelrdgdkgrylg kgvlkaveninstlgpallqkklsvadqekvdkfmieldgtenkskfganailgvslavc kagaaekgvplyrhiadlagn
Timeline for d2xsxb1: