Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Human (Homo sapiens), HLA-B2705 [TaxId:9606] [48949] (1 PDB entry) |
Domain d1hsab1: 1hsa B: [20733] Other proteins in same PDB: d1hsaa2, d1hsad2 |
PDB Entry: 1hsa (more details), 2.1 Å
SCOP Domain Sequences for d1hsab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsab1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B2705} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1hsab1: