SCOPe 2.06: Domain d2xsdc2: 2xsd C:343-397

Lineage for d2xsdc2 (2xsd C:343-397)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries)

8. Domain d2xsdc2: 2xsd C:343-397 [207328]
   Other proteins in same PDB: d2xsdc1
   automated match to d1octc1
   protein/DNA complex; complexed with edo

Details for d2xsdc2

PDB Entry: 2xsd, 2.05 Å

PDB Description: crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna

PDB Compounds: (C:) pou domain, class 3, transcription factor 1

SCOPe Domain Sequences for d2xsdc2:

Sequence; same for both SEQRES and ATOM records:

>d2xsdc2 a.4.1.0 (C:343-397) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sievgvkgaleshflkcpkpsaheitgladslqlekevvrvwfcnrrqkekrmtp

Timeline for d2xsdc2:

• d2xsdc2 first appeared in SCOPe 2.03
  
• d2xsdc2 appears in SCOPe 2.05
  
• d2xsdc2 appears in SCOPe 2.07
  
• d2xsdc2 appears in the current release, SCOPe 2.08