| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
| Protein automated matches [190907] (21 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226005] (1 PDB entry) |
| Domain d2xsdc1: 2xsd C:247-319 [207327] Other proteins in same PDB: d2xsdc2 automated match to d1cqta2 protein/DNA complex; complexed with edo |
PDB Entry: 2xsd (more details), 2.05 Å
SCOPe Domain Sequences for d2xsdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xsdc1 a.35.1.0 (C:247-319) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
apssddleqfakqfkqrriklgftqadvglalgtlygnvfsqtticrfealqlsfknmck
lkpllnkwleetd
Timeline for d2xsdc1: