Lineage for d2xrla2 (2xrl A:68-208)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502122Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1502123Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1502124Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1502402Protein automated matches [226970] (3 species)
    not a true protein
  7. 1502410Species Escherichia coli [TaxId:562] [226229] (5 PDB entries)
  8. 1502413Domain d2xrla2: 2xrl A:68-208 [207326]
    Other proteins in same PDB: d2xrla1
    automated match to d1qpia2
    complexed with cl, dxt, mg

Details for d2xrla2

PDB Entry: 2xrl (more details), 1.85 Å

PDB Description: tet-repressor class d t103a with doxycycline
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xrla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xrla2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgarpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

SCOPe Domain Coordinates for d2xrla2:

Click to download the PDB-style file with coordinates for d2xrla2.
(The format of our PDB-style files is described here.)

Timeline for d2xrla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xrla1