Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein automated matches [226970] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [226229] (9 PDB entries) |
Domain d2xrla2: 2xrl A:68-208 [207326] Other proteins in same PDB: d2xrla1, d2xrla3 automated match to d1qpia2 complexed with cl, dxt, mg |
PDB Entry: 2xrl (more details), 1.85 Å
SCOPe Domain Sequences for d2xrla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xrla2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]} lpaageswqsflrnnamsfrrallryrdgakvhlgarpdekqydtvetqlrfmtengfsl rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl hgleslirgfevqltallqiv
Timeline for d2xrla2: