Lineage for d2xrla1 (2xrl A:2-67)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721270Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1721271Protein automated matches [190674] (16 species)
    not a true protein
  7. 1721293Species Escherichia coli [TaxId:562] [226228] (7 PDB entries)
  8. 1721297Domain d2xrla1: 2xrl A:2-67 [207325]
    Other proteins in same PDB: d2xrla2
    automated match to d1qpia1
    complexed with cl, dxt, mg

Details for d2xrla1

PDB Entry: 2xrl (more details), 1.85 Å

PDB Description: tet-repressor class d t103a with doxycycline
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xrla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xrla1 a.4.1.0 (A:2-67) automated matches {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOPe Domain Coordinates for d2xrla1:

Click to download the PDB-style file with coordinates for d2xrla1.
(The format of our PDB-style files is described here.)

Timeline for d2xrla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xrla2