Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Escherichia coli [TaxId:562] [226228] (11 PDB entries) |
Domain d2xrla1: 2xrl A:3-67 [207325] Other proteins in same PDB: d2xrla2, d2xrla3 automated match to d1qpia1 complexed with cl, dxt, mg |
PDB Entry: 2xrl (more details), 1.85 Å
SCOPe Domain Sequences for d2xrla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xrla1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]} rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar hhdys
Timeline for d2xrla1: