Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d2xqyk2: 2xqy K:108-214 [207320] Other proteins in same PDB: d2xqyk1, d2xqyl1 automated match to d1dqdl2 complexed with nag |
PDB Entry: 2xqy (more details), 2.05 Å
SCOPe Domain Sequences for d2xqyk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xqyk2 b.1.1.2 (K:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2xqyk2: