Lineage for d2xpva2 (2xpv A:68-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728122Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2728123Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. 2728125Domain d2xpva2: 2xpv A:68-208 [207316]
    Other proteins in same PDB: d2xpva1, d2xpva3
    automated match to d1bjza2
    complexed with cl, mg, miy

Details for d2xpva2

PDB Entry: 2xpv (more details), 1.49 Å

PDB Description: tetr(d) in complex with minocycline and magnesium.
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpva2:

Sequence, based on SEQRES records: (download)

>d2xpva2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d2xpva2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalenlppllrealqimdsddgeqaflhgleslir
gfevqltallqiv

SCOPe Domain Coordinates for d2xpva2:

Click to download the PDB-style file with coordinates for d2xpva2.
(The format of our PDB-style files is described here.)

Timeline for d2xpva2: