SCOPe 2.03: Domain d2xpua2: 2xpu A:68-208

Lineage for d2xpua2 (2xpu A:68-208)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (25 PDB entries)

8. Domain d2xpua2: 2xpu A:68-208 [207314]
   Other proteins in same PDB: d2xpua1
   automated match to d1bjza2
   complexed with cl, so4, tdc

Details for d2xpua2

PDB Entry: 2xpu, 1.55 Å

PDB Description: tetr(d) in complex with anhydrotetracycline.

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpua2:

Sequence, based on SEQRES records:

>d2xpua2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records):

>d2xpua2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrenlppllrealqimdsddgeqaflhgles
lirgfevqltallqiv

Timeline for d2xpua2:

• d2xpua2 is new in SCOPe 2.03-stable
  
• d2xpua2 appears in SCOPe 2.04
  
• d2xpua2 appears in the current release, SCOPe 2.08