Lineage for d2xpua2 (2xpu A:68-208)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008349Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2008350Species Escherichia coli [TaxId:562] [48501] (28 PDB entries)
  8. 2008355Domain d2xpua2: 2xpu A:68-208 [207314]
    Other proteins in same PDB: d2xpua1, d2xpua3
    automated match to d1bjza2
    complexed with cl, so4, tdc

Details for d2xpua2

PDB Entry: 2xpu (more details), 1.55 Å

PDB Description: TetR(D) in complex with anhydrotetracycline.
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpua2:

Sequence, based on SEQRES records: (download)

>d2xpua2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d2xpua2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrenlppllrealqimdsddgeqaflhgles
lirgfevqltallqiv

SCOPe Domain Coordinates for d2xpua2:

Click to download the PDB-style file with coordinates for d2xpua2.
(The format of our PDB-style files is described here.)

Timeline for d2xpua2: