Lineage for d1i1fd1 (1i1f D:182-275)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654706Domain d1i1fd1: 1i1f D:182-275 [20730]
    Other proteins in same PDB: d1i1fa2, d1i1fb_, d1i1fd2, d1i1fe_

Details for d1i1fd1

PDB Entry: 1i1f (more details), 2.8 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y
PDB Compounds: (D:) protein (class I histocompatibility antigen, gogo-a0201 alpha chain)

SCOP Domain Sequences for d1i1fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1fd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1i1fd1:

Click to download the PDB-style file with coordinates for d1i1fd1.
(The format of our PDB-style files is described here.)

Timeline for d1i1fd1: