SCOP 1.61: Domain d1i1fd1: 1i1f D:182-275

Lineage for d1i1fd1 (1i1f D:182-275)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries)

8. Domain d1i1fd1: 1i1f D:182-275 [20730]
   Other proteins in same PDB: d1i1fa2, d1i1fd2

Details for d1i1fd1

PDB Entry: 1i1f, 2.8 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y

SCOP Domain Sequences for d1i1fd1:

Sequence; same for both SEQRES and ATOM records:

>d1i1fd1 b.1.1.2 (D:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1i1fd1:

• d1i1fd1 first appeared (with stable ids) in SCOP 1.55
  
• d1i1fd1 appears in SCOP 1.59
  
• d1i1fd1 appears in SCOP 1.63
  
• d1i1fd1 appears in the current release, SCOPe 2.08