Lineage for d2xp6a2 (2xp6 A:51-163)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548640Protein automated matches [191209] (6 species)
    not a true protein
  7. 2548646Species Human (Homo sapiens) [TaxId:9606] [189839] (58 PDB entries)
  8. 2548700Domain d2xp6a2: 2xp6 A:51-163 [207298]
    Other proteins in same PDB: d2xp6a1
    automated match to d2itka2
    complexed with 12p, 4g2

Details for d2xp6a2

PDB Entry: 2xp6 (more details), 1.9 Å

PDB Description: discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2xp6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xp6a2 d.26.1.1 (A:51-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmakpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d2xp6a2:

Click to download the PDB-style file with coordinates for d2xp6a2.
(The format of our PDB-style files is described here.)

Timeline for d2xp6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xp6a1