| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein automated matches [191209] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189839] (58 PDB entries) |
| Domain d2xp6a2: 2xp6 A:51-163 [207298] Other proteins in same PDB: d2xp6a1 automated match to d2itka2 complexed with 12p, 4g2 |
PDB Entry: 2xp6 (more details), 1.9 Å
SCOPe Domain Sequences for d2xp6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xp6a2 d.26.1.1 (A:51-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmakpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d2xp6a2: