SCOPe 2.08: Domain d2xp6a2: 2xp6 A:51-163

Lineage for d2xp6a2 (2xp6 A:51-163)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)

8. Domain d2xp6a2: 2xp6 A:51-163 [207298]
   Other proteins in same PDB: d2xp6a1
   automated match to d2itka2
   complexed with 12p, 4g2

Details for d2xp6a2

PDB Entry: 2xp6, 1.9 Å

PDB Description: discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2xp6a2:

Sequence; same for both SEQRES and ATOM records:

>d2xp6a2 d.26.1.1 (A:51-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmakpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d2xp6a2:

• d2xp6a2 first appeared in SCOPe 2.03
  
• d2xp6a2 appears in SCOPe 2.07