| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species) Domain 1 is a WW-domain |
| Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries) |
| Domain d2xp3a2: 2xp3 A:51-163 [207292] Other proteins in same PDB: d2xp3a1 automated match to d2itka2 complexed with 12p, b21 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2xp3 (more details), 2 Å
SCOPe Domain Sequences for d2xp3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xp3a2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d2xp3a2: