SCOPe 2.08: Domain d2xofb_: 2xof B:

Lineage for d2xofb_ (2xof B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d2xofb_: 2xof B: [207289]
   automated match to d1jqcb_
   complexed with feo

Details for d2xofb_

PDB Entry: 2xof, 2.2 Å

PDB Description: ribonucleotide reductase y122no2y modified r2 subunit of e. coli

PDB Compounds: (B:) ribonucleoside-diphosphate reductase 1 subunit beta

SCOPe Domain Sequences for d2xofb_:

Sequence; same for both SEQRES and ATOM records:

>d2xofb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

Timeline for d2xofb_:

• d2xofb_ first appeared in SCOPe 2.03
  
• d2xofb_ appears in SCOPe 2.07