Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein automated matches [226995] (7 species) not a true protein |
Species Escherichia coli [TaxId:562] [226085] (1 PDB entry) |
Domain d2xnja2: 2xnj A:110-256 [207284] Other proteins in same PDB: d2xnja1, d2xnjb1 automated match to d1fdra2 complexed with fad, gol, na, nap, trs, zn |
PDB Entry: 2xnj (more details), 1.9 Å
SCOPe Domain Sequences for d2xnja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xnja2 c.25.1.1 (A:110-256) automated matches {Escherichia coli [TaxId: 562]} devphcetlwmlatgtaigpylsilrlgkdldrfknlvlvhaaryaadlsylplmqelek ryegklriqtvvsretaagsltgripaliesgelestiglpmnketshvmlcgnpqmvrd tqqllketrqmtkhlrrrpghmtaehy
Timeline for d2xnja2: