SCOPe 2.03: Domain d2xncb1: 2xnc B:13-139

Lineage for d2xncb1 (2xnc B:13-139)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (15 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [226803] (3 PDB entries)

8. Domain d2xncb1: 2xnc B:13-139 [207281]
   Other proteins in same PDB: d2xnca2, d2xncb2
   automated match to d1frna1
   complexed with fad, so4

Details for d2xncb1

PDB Entry: 2xnc, 2.9 Å

PDB Description: crystal structure of an engineered ferredoxin nadp reductase (fnr) from pisum sativum

PDB Compounds: (B:) Ferredoxin--NADP reductase, leaf isozyme, chloroplastic

SCOPe Domain Sequences for d2xncb1:

Sequence; same for both SEQRES and ATOM records:

>d2xncb1 b.43.4.0 (B:13-139) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi
vpdgidkngkphklrlysiassaigdfgdsktvslcvkrvpdgvcsnflcdlkpgsevki
tgpvgke

Timeline for d2xncb1:

• d2xncb1 is new in SCOPe 2.03-stable
  
• d2xncb1 appears in SCOPe 2.04
  
• d2xncb1 appears in the current release, SCOPe 2.08