SCOPe 2.07: Domain d2xnac2: 2xna C:102-215

Lineage for d2xnac2 (2xna C:102-215)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54347] (5 PDB entries)

8. Domain d2xnac2: 2xna C:102-215 [207278]
   Other proteins in same PDB: d2xnaa1, d2xnaa2, d2xnab1, d2xnab2, d2xnac1
   automated match to d1f77a2
   complexed with gol, na

Details for d2xnac2

PDB Entry: 2xna, 2.1 Å

PDB Description: crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin

PDB Compounds: (C:) enterotoxin h

SCOPe Domain Sequences for d2xnac2:

Sequence; same for both SEQRES and ATOM records:

>d2xnac2 d.15.6.1 (C:102-215) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlytkk

Timeline for d2xnac2:

• d2xnac2 first appeared in SCOPe 2.03
  
• d2xnac2 appears in SCOPe 2.06
  
• d2xnac2 appears in the current release, SCOPe 2.08