SCOPe 2.03: Domain d2xnab2: 2xna B:116-243

Lineage for d2xnab2 (2xna B:116-243)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d2xnab2: 2xna B:116-243 [207276]
   Other proteins in same PDB: d2xnaa2, d2xnac1, d2xnac2
   automated match to d1lp9f2
   complexed with gol, na

Details for d2xnab2

PDB Entry: 2xna, 2.1 Å

PDB Description: crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin

PDB Compounds: (B:) t cell receptor beta-1 chain c region

SCOPe Domain Sequences for d2xnab2:

Sequence; same for both SEQRES and ATOM records:

>d2xnab2 b.1.1.0 (B:116-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d2xnab2:

• d2xnab2 is new in SCOPe 2.03-stable
  
• d2xnab2 appears in SCOPe 2.04
  
• d2xnab2 appears in the current release, SCOPe 2.08