![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
![]() | Domain d2xnab1: 2xna B:3-115 [207275] Other proteins in same PDB: d2xnaa2, d2xnac1, d2xnac2 automated match to d1lp9f1 complexed with gol, na |
PDB Entry: 2xna (more details), 2.1 Å
SCOPe Domain Sequences for d2xnab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xnab1 b.1.1.0 (B:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} dggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdi aegysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvte
Timeline for d2xnab1:
![]() Domains from other chains: (mouse over for more information) d2xnaa1, d2xnaa2, d2xnac1, d2xnac2 |