SCOPe 2.04: Domain d2xnaa2: 2xna A:112-200

Lineage for d2xnaa2 (2xna A:112-200)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d2xnaa2: 2xna A:112-200 [207274]
   Other proteins in same PDB: d2xnaa1, d2xnab1, d2xnab2, d2xnac1, d2xnac2
   automated match to d1qrnd2
   complexed with gol, na

Details for d2xnaa2

PDB Entry: 2xna, 2.1 Å

PDB Description: crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin

PDB Compounds: (A:) t cell receptor alpha chain c region

SCOPe Domain Sequences for d2xnaa2:

Sequence; same for both SEQRES and ATOM records:

>d2xnaa2 b.1.1.2 (A:112-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d2xnaa2:

• d2xnaa2 first appeared in SCOPe 2.03
  
• d2xnaa2 appears in SCOPe 2.05
  
• d2xnaa2 appears in the current release, SCOPe 2.08