Lineage for d2xlna_ (2xln A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450848Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 1450849Protein D-alanyl-D-alanine carboxypeptidase Dac [144043] (1 species)
  7. 1450850Species Actinomadura sp. [TaxId:1989] [144044] (16 PDB entries)
    Uniprot P39045 50-516
  8. 1450871Domain d2xlna_: 2xln A: [207268]
    automated match to d1w79a1
    complexed with co, ewa, so4

Details for d2xlna_

PDB Entry: 2xln (more details), 2.4 Å

PDB Description: Crystal structure of a complex between Actinomadura R39 DD-peptidase and a boronate inhibitor
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase,

SCOPe Domain Sequences for d2xlna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xlna_ e.3.1.3 (A:) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]}
rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapeg

SCOPe Domain Coordinates for d2xlna_:

Click to download the PDB-style file with coordinates for d2xlna_.
(The format of our PDB-style files is described here.)

Timeline for d2xlna_: