Lineage for d2xkra_ (2xkr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005739Species Mycobacterium tuberculosis [TaxId:83332] [226004] (12 PDB entries)
  8. 2005745Domain d2xkra_: 2xkr A: [207267]
    automated match to d3a4ga_
    complexed with hem, pg4

Details for d2xkra_

PDB Entry: 2xkr (more details), 1.6 Å

PDB Description: crystal structure of mycobacterium tuberculosis cyp142: a novel cholesterol oxidase
PDB Compounds: (A:) putative cytochrome p450 142

SCOPe Domain Sequences for d2xkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xkra_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apdvdladgnfyasrearaayrwmranqpvfrdrnglaaastyqavidaerqpelfsnag
girpdqpalpmmidmddpahllrrklvnagftrkrvkdkeasiaalcdtlidavcergec
dfvrdlaaplpmavigdmlgvrpeqrdmflrwsddlvtflsshvsqedfqitmdafaayn
dftratiaarradptddlvsvlvssevdgerlsddelvmetlliliggdettrhtlsggt
eqllrnrdqwdllqrdpsllpgaieemlrwtapvknmcrvltadtefhgtalcagekmml
lfesanfdeavfcepekfdvqrnpnshlafgfgthfclgnqlarlelslmtervlrrlpd
lrlvaddsvlplrpanfvsglesmpvvftpspplg

SCOPe Domain Coordinates for d2xkra_:

Click to download the PDB-style file with coordinates for d2xkra_.
(The format of our PDB-style files is described here.)

Timeline for d2xkra_: