Lineage for d2xhia2 (2xhi A:136-325)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721021Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2721098Protein automated matches [227058] (1 species)
    not a true protein
  7. 2721099Species Human (Homo sapiens) [TaxId:9606] [226066] (2 PDB entries)
  8. 2721100Domain d2xhia2: 2xhi A:136-325 [207255]
    Other proteins in same PDB: d2xhia1
    automated match to d1ebma1
    protein/DNA complex; complexed with ca; mutant

Details for d2xhia2

PDB Entry: 2xhi (more details), 1.55 Å

PDB Description: Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA glycosylase
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2xhia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhia2 a.96.1.3 (A:136-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtcvadkic
lmaldkpqavpvnvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOPe Domain Coordinates for d2xhia2:

Click to download the PDB-style file with coordinates for d2xhia2.
(The format of our PDB-style files is described here.)

Timeline for d2xhia2: