Lineage for d2xhia1 (2xhi A:10-135)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1668834Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1669013Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 1669014Protein automated matches [227057] (3 species)
    not a true protein
  7. 1669028Species Human (Homo sapiens) [TaxId:9606] [226065] (1 PDB entry)
  8. 1669029Domain d2xhia1: 2xhi A:10-135 [207254]
    Other proteins in same PDB: d2xhia2
    automated match to d1m3qa2
    protein/DNA complex; complexed with ca; mutant

Details for d2xhia1

PDB Entry: 2xhi (more details), 1.55 Å

PDB Description: Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA glycosylase
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2xhia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhia1 d.129.1.0 (A:10-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqt
eeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqg
vrllrq

SCOPe Domain Coordinates for d2xhia1:

Click to download the PDB-style file with coordinates for d2xhia1.
(The format of our PDB-style files is described here.)

Timeline for d2xhia1: