Lineage for d2xhba1 (2xhb A:1-347)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124334Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
    contains Pfam PF00929
  6. 2124711Protein automated matches [190162] (5 species)
    not a true protein
  7. 2124755Species Thermococcus gorgonarius [TaxId:71997] [225933] (3 PDB entries)
  8. 2124757Domain d2xhba1: 2xhb A:1-347 [207252]
    Other proteins in same PDB: d2xhba2
    automated match to d1qqca1
    protein/DNA complex; complexed with na

Details for d2xhba1

PDB Entry: 2xhb (more details), 2.72 Å

PDB Description: crystal structure of dna polymerase from thermococcus gorgonarius in complex with hypoxanthine-containing dna
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2xhba1:

Sequence, based on SEQRES records: (download)

>d2xhba1 c.55.3.5 (A:1-347) automated matches {Thermococcus gorgonarius [TaxId: 71997]}
mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
lidkglipmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknidlpy
vdvvstekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs

Sequence, based on observed residues (ATOM records): (download)

>d2xhba1 c.55.3.5 (A:1-347) automated matches {Thermococcus gorgonarius [TaxId: 71997]}
mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
lidkglipmegdeelkmlafdietlefaegpilmisyadeegarvitwknidlpyvdvvs
tekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepkiqrmg
drfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawetgegl
ervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs

SCOPe Domain Coordinates for d2xhba1:

Click to download the PDB-style file with coordinates for d2xhba1.
(The format of our PDB-style files is described here.)

Timeline for d2xhba1: