![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein automated matches [190162] (6 species) not a true protein |
![]() | Species Thermococcus gorgonarius [TaxId:71997] [225933] (6 PDB entries) |
![]() | Domain d2xhba1: 2xhb A:1-347 [207252] Other proteins in same PDB: d2xhba2 automated match to d1qqca1 protein/DNA complex; complexed with na |
PDB Entry: 2xhb (more details), 2.72 Å
SCOPe Domain Sequences for d2xhba1:
Sequence, based on SEQRES records: (download)
>d2xhba1 c.55.3.5 (A:1-347) automated matches {Thermococcus gorgonarius [TaxId: 71997]} mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry lidkglipmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknidlpy vdvvstekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepk iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs
>d2xhba1 c.55.3.5 (A:1-347) automated matches {Thermococcus gorgonarius [TaxId: 71997]} mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry lidkglipmegdeelkmlafdietlefaegpilmisyadeegarvitwknidlpyvdvvs tekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepkiqrmg drfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawetgegl ervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs
Timeline for d2xhba1: