Lineage for d2xh4d1 (2xh4 D:1-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947972Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries)
  8. 2947988Domain d2xh4d1: 2xh4 D:1-140 [207245]
    Other proteins in same PDB: d2xh4a2, d2xh4a3, d2xh4b2, d2xh4b3, d2xh4c2, d2xh4c3, d2xh4d2, d2xh4d3
    automated match to d1pdza2
    complexed with 2pg, mg; mutant

Details for d2xh4d1

PDB Entry: 2xh4 (more details), 1.7 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39a d321a mutant of yeast enolase 1
PDB Compounds: (D:) enolase 1

SCOPe Domain Sequences for d2xh4d1:

Sequence, based on SEQRES records: (download)

>d2xh4d1 d.54.1.0 (D:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlsksk

Sequence, based on observed residues (ATOM records): (download)

>d2xh4d1 d.54.1.0 (D:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsggvlhavknvndviapafvkanid
vkdqkavddflisldgtanksklganailgvslaasraaaaeknvplykhladlsksk

SCOPe Domain Coordinates for d2xh4d1:

Click to download the PDB-style file with coordinates for d2xh4d1.
(The format of our PDB-style files is described here.)

Timeline for d2xh4d1: